PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10020789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 359aa    MW: 41003.8 Da    PI: 4.93
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10020789genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.11.5e-15343242
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                  i+n++nr+ t+ kR++ +lKK eE S+LC++e+++++f +
  Lus10020789  3 LIKNERNRSNTYKKRKANLLKKMEEFSILCGVEACLVVFQP 43
                 59************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.4E-7153IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-17189IPR002100Transcription factor, MADS-box
CDDcd002662.28E-17185No hitNo description
PROSITE profilePS5006614.339141IPR002100Transcription factor, MADS-box
PfamPF003193.7E-16443IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MELIKNERNR SNTYKKRKAN LLKKMEEFSI LCGVEACLVV FQPPNLTEDG GDQLQTWPSD  60
RYSVDATIQR YRTSDGPKRC YHLSDYFAEK KKRVGVELSK INKLIYSRKF PTWDARIDRF  120
SADQLKALLG KLDSKIETAD QKLECFNLIP EHDQFLVPVR NFEQFGLASD YYGNDFQQVY  180
CNDQSFQFGN HDQGSFMAML NPNYFGSLYW DQDNNFGYYD DPPVNNLDNI GTELILSPEK  240
MRTIDFEPFG HHHLANQSEG QMVAAKVENA TRRFGVYGGE QSMVTSSYGS SMEFGEYGMM  300
SYSDGSYMNS GQTIQAPVEM QFQMSGGSYL QRQFSQELDG GGHQAFSGFE KLLICQSE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.16e-22AGAMOUS-like 82